Lineage for d4ln3g_ (4ln3 G:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531708Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1531709Protein automated matches [227017] (14 species)
    not a true protein
  7. 1531759Species Influenza a virus [TaxId:1332244] [228093] (9 PDB entries)
  8. 1531773Domain d4ln3g_: 4ln3 G: [235422]
    Other proteins in same PDB: d4ln3b_, d4ln3d_, d4ln3f_, d4ln3h_, d4ln3j_, d4ln3l_
    automated match to d4ln3e_
    complexed with nag

Details for d4ln3g_

PDB Entry: 4ln3 (more details), 2.65 Å

PDB Description: the crystal structure of hemagglutinin from a h7n9 influenza virus (a/shanghai/1/2013)
PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d4ln3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ln3g_ b.19.1.0 (G:) automated matches {Influenza a virus [TaxId: 1332244]}
gdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgt
itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysg
irtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgst
aeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfn
gafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpry
vkqrslllatgmknvp

SCOPe Domain Coordinates for d4ln3g_:

Click to download the PDB-style file with coordinates for d4ln3g_.
(The format of our PDB-style files is described here.)

Timeline for d4ln3g_: