SCOPe 2.03: Domain d4ln3g_: 4ln3 G:

Lineage for d4ln3g_ (4ln3 G:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (8 species)
   not a true protein

7. Species Influenza a virus [TaxId:1332244] [228093] (9 PDB entries)

8. Domain d4ln3g_: 4ln3 G: [235422]
   automated match to d4ln3e_
   complexed with nag

Details for d4ln3g_

PDB Entry: 4ln3, 2.65 Å

PDB Description: the crystal structure of hemagglutinin from a h7n9 influenza virus (a/shanghai/1/2013)

PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d4ln3g_:

Sequence; same for both SEQRES and ATOM records:

>d4ln3g_ b.19.1.0 (G:) automated matches {Influenza a virus [TaxId: 1332244]}
gdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgt
itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysg
irtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgst
aeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfn
gafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpry
vkqrslllatgmknvp

Timeline for d4ln3g_:

• d4ln3g_ is new in SCOPe 2.03-stable
  
• d4ln3g_ appears in SCOPe 2.04
  
• d4ln3g_ appears in the current release, SCOPe 2.08