Lineage for d4lmrb2 (4lmr B:148-314)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1441394Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1441395Protein automated matches [226850] (21 species)
    not a true protein
  7. 1441403Species Bacillus cereus [TaxId:226900] [226735] (2 PDB entries)
  8. 1441409Domain d4lmrb2: 4lmr B:148-314 [235417]
    Other proteins in same PDB: d4lmra1, d4lmrb1
    automated match to d4ln1d2

Details for d4lmrb2

PDB Entry: 4lmr (more details), 2.45 Å

PDB Description: crystal structure of l-lactate dehydrogenase from bacillus cereus atcc 14579, nysgrc target 029452
PDB Compounds: (B:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d4lmrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmrb2 d.162.1.0 (B:148-314) automated matches {Bacillus cereus [TaxId: 226900]}
ttldsarfrymlgeyfdigphnihayiigehgdtelpvwshvsvgiqklqtllekdntyn
qedldkifinvrdaayhiierkgatyygigmsllrvtkailndensvltvsaylegqygq
kdvyigvpavlnrggvreilevelsedeelkfdhsvqvlketmapvl

SCOPe Domain Coordinates for d4lmrb2:

Click to download the PDB-style file with coordinates for d4lmrb2.
(The format of our PDB-style files is described here.)

Timeline for d4lmrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lmrb1