Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Tryparedoxin peroxidase (thioredoxin peroxidase homologue) [64064] (2 species) |
Species Trypanosoma cruzi [TaxId:5693] [117598] (1 PDB entry) Uniprot O96763 |
Domain d4llrj_: 4llr J: [235412] |
PDB Entry: 4llr (more details), 2.8 Å
SCOPe Domain Sequences for d4llrj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4llrj_ c.47.1.10 (J:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} gdaklnhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt mkpdpekskeyfga
Timeline for d4llrj_: