Lineage for d4llrj_ (4llr J:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853530Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1853848Protein Tryparedoxin peroxidase (thioredoxin peroxidase homologue) [64064] (2 species)
  7. 1853860Species Trypanosoma cruzi [TaxId:5693] [117598] (1 PDB entry)
    Uniprot O96763
  8. 1853870Domain d4llrj_: 4llr J: [235412]

Details for d4llrj_

PDB Entry: 4llr (more details), 2.8 Å

PDB Description: Tryparedoxin peroxidase (TXNPX) from trypanosoma cruzi in the reduced state
PDB Compounds: (J:) tryparedoxin peroxidase

SCOPe Domain Sequences for d4llrj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4llrj_ c.47.1.10 (J:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]}
gdaklnhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
mkpdpekskeyfga

SCOPe Domain Coordinates for d4llrj_:

Click to download the PDB-style file with coordinates for d4llrj_.
(The format of our PDB-style files is described here.)

Timeline for d4llrj_: