Lineage for d4llra_ (4llr A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1369372Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1369704Protein automated matches [190100] (15 species)
    not a true protein
  7. 1369892Species Trypanosoma cruzi [TaxId:5693] [228237] (1 PDB entry)
  8. 1369893Domain d4llra_: 4llr A: [235410]
    automated match to d4llrd_

Details for d4llra_

PDB Entry: 4llr (more details), 2.8 Å

PDB Description: Tryparedoxin peroxidase (TXNPX) from trypanosoma cruzi in the reduced state
PDB Compounds: (A:) tryparedoxin peroxidase

SCOPe Domain Sequences for d4llra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4llra_ c.47.1.10 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
gdaklnhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
mkpdpekskeyfga

SCOPe Domain Coordinates for d4llra_:

Click to download the PDB-style file with coordinates for d4llra_.
(The format of our PDB-style files is described here.)

Timeline for d4llra_: