| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein automated matches [190100] (15 species) not a true protein |
| Species Trypanosoma cruzi [TaxId:5693] [228237] (1 PDB entry) |
| Domain d4llrb_: 4llr B: [235404] automated match to d4llrd_ |
PDB Entry: 4llr (more details), 2.8 Å
SCOPe Domain Sequences for d4llrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4llrb_ c.47.1.10 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
gdaklnhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
mkpdpekskeyfga
Timeline for d4llrb_: