SCOPe 2.08: Domain d4llac1: 4lla C:4-99

Lineage for d4llac1 (4lla C:4-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4llac1: 4lla C:4-99 [235402]
   automated match to d4llaa1

Details for d4llac1

PDB Entry: 4lla, 2.5 Å

PDB Description: Crystal structure of D3D4 domain of the LILRB2 molecule

PDB Compounds: (C:) Leukocyte immunoglobulin-like receptor subfamily B member 2

SCOPe Domain Sequences for d4llac1:

Sequence; same for both SEQRES and ATOM records:

>d4llac1 b.1.1.0 (C:4-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skkpslsvqpgpvmapgesltlqcvsdvgydrfvlykegerdlrqlpgrqpqaglsqanf
tlgpvsrsyggqyrcygahnlssecsapsdpldili

Timeline for d4llac1:

• d4llac1 first appeared in SCOPe 2.03
  
• d4llac1 appears in SCOPe 2.07