Lineage for d4ll9b1 (4ll9 B:2-100)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758738Domain d4ll9b1: 4ll9 B:2-100 [235398]
    automated match to d4ll9a1
    complexed with iod

Details for d4ll9b1

PDB Entry: 4ll9 (more details), 2.69 Å

PDB Description: Crystal structure of D3D4 domain of the LILRB1 molecule
PDB Compounds: (B:) Leukocyte immunoglobulin-like receptor subfamily B member 1

SCOPe Domain Sequences for d4ll9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ll9b1 b.1.1.0 (B:2-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vskkpslsvqpgpivapeetltlqcgsdagynrfvlykdgerdflqlagaqpqaglsqan
ftlgpvsrsyggqyrcygahnlssewsapsdpldiliag

SCOPe Domain Coordinates for d4ll9b1:

Click to download the PDB-style file with coordinates for d4ll9b1.
(The format of our PDB-style files is described here.)

Timeline for d4ll9b1: