Lineage for d4lkka_ (4lkk A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778763Species Influenza A virus [TaxId:11320] [228462] (15 PDB entries)
  8. 1778781Domain d4lkka_: 4lkk A: [235397]
    Other proteins in same PDB: d4lkkb_
    automated match to d4lkia_
    complexed with nag; mutant

Details for d4lkka_

PDB Entry: 4lkk (more details), 2.49 Å

PDB Description: the structure of hemagglutinin l226q mutant (h3 numbering) from a avian-origin h7n9 influenza virus (a/anhui/1/2013) in complex with human receptor analog 6'slnln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4lkka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lkka_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]}
iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg
ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt
ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvstaeq
tklygsgnklvtvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfngaf
iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq
rslllatgmknvpe

SCOPe Domain Coordinates for d4lkka_:

Click to download the PDB-style file with coordinates for d4lkka_.
(The format of our PDB-style files is described here.)

Timeline for d4lkka_: