Lineage for d4lk5a_ (4lk5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100345Species Mycobacterium avium [TaxId:262316] [226673] (2 PDB entries)
  8. 2100347Domain d4lk5a_: 4lk5 A: [235391]
    automated match to d4k2na_

Details for d4lk5a_

PDB Entry: 4lk5 (more details), 2.5 Å

PDB Description: Crystal structure of a enoyl-CoA hydratase from Mycobacterium avium subsp. paratuberculosis K-10
PDB Compounds: (A:) enoyl-coa hydratase

SCOPe Domain Sequences for d4lk5a_:

Sequence, based on SEQRES records: (download)

>d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}
lapvagldvtlsdgvfsvtinrpdslnsltvpvitgiadameyaatdpevkvvriggagr
gfssgagisaddvsdgggvppdeiileinrlvraiaalphpvvavvqgpaagvgvsiala
cdvvlasenaffmlaftkiglmpdggasalvaaavgriramqmallperlpaaealawgl
vtavypadefeaevdkviarllsgpavafaktklainaatlteldpalqrefdgqsvllk
spdfvegata

Sequence, based on observed residues (ATOM records): (download)

>d4lk5a_ c.14.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 262316]}
lapvagldvtlsdgvfsvtinrpdslnsltvpvitgiadameyaatdpevkvvriggagr
gfssgagisppdeiileinrlvraiaalphpvvavvqgpaagvgvsialacdvvlasena
ffmlaftkiglmpdggasalvaaavgriramqmallperlpaaealawglvtavypadef
eaevdkviarllsgpavafaktklainaatlteldpalqrefdgqsvllkspdfvegata

SCOPe Domain Coordinates for d4lk5a_:

Click to download the PDB-style file with coordinates for d4lk5a_.
(The format of our PDB-style files is described here.)

Timeline for d4lk5a_: