SCOPe 2.07: Domain d4ljdc1: 4ljd C:2-223

Lineage for d4ljdc1 (4ljd C:2-223)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (25 species)
   not a true protein

7. Species Lobophyllia hemprichii [TaxId:46758] [187486] (25 PDB entries)

8. Domain d4ljdc1: 4ljd C:2-223 [235390]
   Other proteins in same PDB: d4ljdc2
   automated match to d4ljdd_
   complexed with so3, so4

Details for d4ljdc1

PDB Entry: 4ljd, 2.5 Å

PDB Description: Structure of a photobleached state of IrisFP under low intensity laser-light

PDB Compounds: (C:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d4ljdc1:

Sequence; same for both SEQRES and ATOM records:

>d4ljdc1 d.22.1.0 (C:2-223) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
hygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfh
gvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykake
kgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn

Timeline for d4ljdc1:

• d4ljdc1 first appeared in SCOPe 2.03, called d4ljdc_
  
• d4ljdc1 appears in SCOPe 2.06
  
• d4ljdc1 appears in the current release, SCOPe 2.08