SCOPe 2.05: Domain d4ljcc_: 4ljc C:

Lineage for d4ljcc_ (4ljc C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (20 species)
   not a true protein

7. Species Lobophyllia hemprichii [TaxId:46758] [187486] (14 PDB entries)

8. Domain d4ljcc_: 4ljc C: [235384]
   automated match to d4ljdd_
   complexed with so3, so4

Details for d4ljcc_

PDB Entry: 4ljc, 1.86 Å

PDB Description: Structure of an X-ray-induced photobleached state of IrisFP

PDB Compounds: (C:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d4ljcc_:

Sequence; same for both SEQRES and ATOM records:

>d4ljcc_ d.22.1.0 (C:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn

Timeline for d4ljcc_:

• d4ljcc_ first appeared in SCOPe 2.03
  
• d4ljcc_ appears in SCOPe 2.04
  
• d4ljcc_ is called d4ljcc1 in SCOPe 2.06
  
• d4ljcc_ appears in the current release, SCOPe 2.08, called d4ljcc1