Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins) an RNA-binding domain |
Protein automated matches [195910] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [195911] (4 PDB entries) |
Domain d4lijb_: 4lij B: [235379] automated match to d4lija_ complexed with po4 |
PDB Entry: 4lij (more details), 1.8 Å
SCOPe Domain Sequences for d4lijb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lijb_ d.51.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qrsvmteeykvpdgmvgfiigrggeqisriqqesgckiqiapdsgglperscmltgtpes vqsakrlldqivekgr
Timeline for d4lijb_: