Lineage for d4lijb_ (4lij B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947178Protein automated matches [195910] (2 species)
    not a true protein
  7. 2947179Species Human (Homo sapiens) [TaxId:9606] [195911] (4 PDB entries)
  8. 2947185Domain d4lijb_: 4lij B: [235379]
    automated match to d4lija_
    complexed with po4

Details for d4lijb_

PDB Entry: 4lij (more details), 1.8 Å

PDB Description: crystal structure of a far upstream element (fuse) binding protein 1 (fubp1) from homo sapiens at 1.95 a resolution
PDB Compounds: (B:) Far upstream element-binding protein 1

SCOPe Domain Sequences for d4lijb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lijb_ d.51.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrsvmteeykvpdgmvgfiigrggeqisriqqesgckiqiapdsgglperscmltgtpes
vqsakrlldqivekgr

SCOPe Domain Coordinates for d4lijb_:

Click to download the PDB-style file with coordinates for d4lijb_.
(The format of our PDB-style files is described here.)

Timeline for d4lijb_: