Lineage for d4lhug2 (4lhu G:126-236)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517946Domain d4lhug2: 4lhu G:126-236 [235378]
    Other proteins in same PDB: d4lhua1, d4lhua2, d4lhub_, d4lhud1, d4lhud2, d4lhug1
    automated match to d4lfhg2
    complexed with bma, cl, jls, mg, nag

Details for d4lhug2

PDB Entry: 4lhu (more details), 2.87 Å

PDB Description: crystal structure of 9c2 tcr bound to cd1d
PDB Compounds: (G:) 9C2 TCR gamma chain

SCOPe Domain Sequences for d4lhug2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhug2 b.1.1.2 (G:126-236) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqldadvspkptiflpsiaetklqkagtylcllekffpdvikihwqekksntilgsqegn
tmktndtymkfswltvpeesldkehrcivrhennkngvdqeiifppiktdv

SCOPe Domain Coordinates for d4lhug2:

Click to download the PDB-style file with coordinates for d4lhug2.
(The format of our PDB-style files is described here.)

Timeline for d4lhug2: