Lineage for d4lhug1 (4lhu G:10-125)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520319Domain d4lhug1: 4lhu G:10-125 [235377]
    Other proteins in same PDB: d4lhua1, d4lhub_, d4lhug2
    automated match to d4lfhg1
    complexed with bma, cl, jls, mg, nag

Details for d4lhug1

PDB Entry: 4lhu (more details), 2.87 Å

PDB Description: crystal structure of 9c2 tcr bound to cd1d
PDB Compounds: (G:) 9C2 TCR gamma chain

SCOPe Domain Sequences for d4lhug1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhug1 b.1.1.0 (G:10-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtksvtrptrssaeitcdltvinafyihwylhqegkapqrllyydvsnskdvlesglspg
kyythtprrwswililrnliendsgvyycatwdrgnpkthyykklfgsgttlvvtd

SCOPe Domain Coordinates for d4lhug1:

Click to download the PDB-style file with coordinates for d4lhug1.
(The format of our PDB-style files is described here.)

Timeline for d4lhug1: