SCOPe 2.06: Domain d4lhra1: 4lhr A:1-132

Lineage for d4lhra1 (4lhr A:1-132)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein automated matches [190798] (8 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [235375] (1 PDB entry)

8. Domain d4lhra1: 4lhr A:1-132 [235376]
   Other proteins in same PDB: d4lhra2
   automated match to d1rn8a_
   complexed with pg4

Details for d4lhra1

PDB Entry: 4lhr, 1.5 Å

PDB Description: crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d4lhra1:

Sequence; same for both SEQRES and ATOM records:

>d4lhra1 b.85.4.1 (A:1-132) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mkldlkildarmrdylpkyattgsagldlracldapvtlkpgdtalvptglaihladpgy
aalilprsglghkhgivlgnlvglidsdyqgelmistwnrgqtefvlnpferlaqlvivp
vvqatfnivgdf

Timeline for d4lhra1:

• d4lhra1 first appeared in SCOPe 2.03, called d4lhra_
  
• d4lhra1 was called d4lhra_ in SCOPe 2.05
  
• d4lhra1 appears in SCOPe 2.07
  
• d4lhra1 appears in the current release, SCOPe 2.08