Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) |
Family c.121.1.0: automated matches [191649] (1 protein) not a true family |
Protein automated matches [191196] (11 species) not a true protein |
Species Lactobacillus rhamnosus [TaxId:568704] [229308] (4 PDB entries) |
Domain d4lfmb_: 4lfm B: [235358] automated match to d4lfmd_ complexed with psj |
PDB Entry: 4lfm (more details), 1.65 Å
SCOPe Domain Sequences for d4lfmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lfmb_ c.121.1.0 (B:) automated matches {Lactobacillus rhamnosus [TaxId: 568704]} miiaigndhivtmqkieisnmlkdmgytvidegtydthrthypiygkkvaedvadgradl givmcgtgigistaadknegiraamcddvtsavyareqlnanvlgiggavvgvhliqdiv kayldatyketpenkklidkidniakpnpdqkdnphffdaelekwaegvyhd
Timeline for d4lfmb_: