SCOPe 2.06: Domain d4lfld_: 4lfl D:

Lineage for d4lfld_ (4lfl D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.0: automated matches [191649] (1 protein)
   not a true family

6. Protein automated matches [191196] (8 species)
   not a true protein

7. Species Lactobacillus rhamnosus [TaxId:568704] [229308] (4 PDB entries)

8. Domain d4lfld_: 4lfl D: [235357]
   automated match to d4lfmd_
   complexed with tg6

Details for d4lfld_

PDB Entry: 4lfl, 1.65 Å

PDB Description: Crystal Structure of D-galactose-6-phosphate isomerase in complex with D-tagatose-6-phosphate

PDB Compounds: (D:) Galactose-6-phosphate isomerase subunit B

SCOPe Domain Sequences for d4lfld_:

Sequence; same for both SEQRES and ATOM records:

>d4lfld_ c.121.1.0 (D:) automated matches {Lactobacillus rhamnosus [TaxId: 568704]}
miiaigndhivtmqkieisnmlkdmgytvidegtydthrthypiygkkvaedvadgradl
givmcgtgigistaadknegiraamcddvtsavyareqlnanvlgiggavvgvhliqdiv
kayldatyketpenkklidkidniakpnpdqkdnphffdaelekwaegvyhd

Timeline for d4lfld_:

• d4lfld_ first appeared in SCOPe 2.03
  
• d4lfld_ appears in SCOPe 2.05
  
• d4lfld_ appears in SCOPe 2.07
  
• d4lfld_ appears in the current release, SCOPe 2.08