![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (21 species) not a true protein |
![]() | Species Streptococcus uberis [TaxId:218495] [235348] (1 PDB entry) |
![]() | Domain d4lfeb_: 4lfe B: [235350] automated match to d3ucaa_ complexed with ipe, mg |
PDB Entry: 4lfe (more details), 1.95 Å
SCOPe Domain Sequences for d4lfeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lfeb_ a.128.1.0 (B:) automated matches {Streptococcus uberis [TaxId: 218495]} dklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqiplteshf kaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgmlae tdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllaypf waaarvaqldenllatfleigmiiglafqvrddilditanfeeigktpkkdvmaekmtyp hllglnesyqildesldqaeailrklsdeiafapqkilslierlrlda
Timeline for d4lfeb_: