SCOPe 2.08: Domain d4lfeb_: 4lfe B:

Lineage for d4lfeb_ (4lfe B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Streptococcus uberis [TaxId:218495] [235348] (2 PDB entries)

8. Domain d4lfeb_: 4lfe B: [235350]
   Other proteins in same PDB: d4lfea2
   automated match to d3ucaa_
   complexed with ipe, mg

Details for d4lfeb_

PDB Entry: 4lfe, 1.95 Å

PDB Description: Crystal structure of geranylgeranyl diphosphate synthase sub1274 (target efi-509455) from streptococcus uberis 0140j with bound magnesium and isopentyl diphosphate, partially liganded complex;

PDB Compounds: (B:) Geranylgeranyl diphosphate synthase

SCOPe Domain Sequences for d4lfeb_:

Sequence; same for both SEQRES and ATOM records:

>d4lfeb_ a.128.1.0 (B:) automated matches {Streptococcus uberis [TaxId: 218495]}
dklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqiplteshf
kaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgmlae
tdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllaypf
waaarvaqldenllatfleigmiiglafqvrddilditanfeeigktpkkdvmaekmtyp
hllglnesyqildesldqaeailrklsdeiafapqkilslierlrlda

Timeline for d4lfeb_:

• d4lfeb_ first appeared in SCOPe 2.03
  
• d4lfeb_ appears in SCOPe 2.07