Lineage for d4lfea1 (4lfe A:1-289)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2011007Species Streptococcus uberis [TaxId:218495] [235348] (2 PDB entries)
  8. 2011010Domain d4lfea1: 4lfe A:1-289 [235349]
    Other proteins in same PDB: d4lfea2
    automated match to d3ucaa_
    complexed with ipe, mg

Details for d4lfea1

PDB Entry: 4lfe (more details), 1.95 Å

PDB Description: Crystal structure of geranylgeranyl diphosphate synthase sub1274 (target efi-509455) from streptococcus uberis 0140j with bound magnesium and isopentyl diphosphate, partially liganded complex;
PDB Compounds: (A:) Geranylgeranyl diphosphate synthase

SCOPe Domain Sequences for d4lfea1:

Sequence, based on SEQRES records: (download)

>d4lfea1 a.128.1.0 (A:1-289) automated matches {Streptococcus uberis [TaxId: 218495]}
mdklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqipltesh
fkaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgmla
etdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllayp
fwaaarvaqldenllatfleigmiiglafqvrddilditanfeeigktpkkdvmaekmty
phllglnesyqildesldqaeailrklsdeiafapqkilslierlrlda

Sequence, based on observed residues (ATOM records): (download)

>d4lfea1 a.128.1.0 (A:1-289) automated matches {Streptococcus uberis [TaxId: 218495]}
mdklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqipltesh
fkaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgmla
etdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllayp
fwaaarvaqldenllatfleigmiiglafqvrddilditakmtyphllglnesyqildes
ldqaeailrklsdeiafapqkilslierlrlda

SCOPe Domain Coordinates for d4lfea1:

Click to download the PDB-style file with coordinates for d4lfea1.
(The format of our PDB-style files is described here.)

Timeline for d4lfea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lfea2
View in 3D
Domains from other chains:
(mouse over for more information)
d4lfeb_