Lineage for d4ldtc_ (4ldt C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1407111Protein automated matches [190124] (12 species)
    not a true protein
  7. 1407121Species Human (Homo sapiens) [TaxId:9606] [186848] (19 PDB entries)
  8. 1407124Domain d4ldtc_: 4ldt C: [235347]
    Other proteins in same PDB: d4ldtb_, d4ldtd_
    automated match to d3a33a_
    complexed with edo, mg

Details for d4ldtc_

PDB Entry: 4ldt (more details), 1.9 Å

PDB Description: the structure of h/ceotub1-ubiquitin aldehyde-ubch5b~ub
PDB Compounds: (C:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4ldtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ldtc_ d.20.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptd
ypfkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddpl
vpeiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d4ldtc_:

Click to download the PDB-style file with coordinates for d4ldtc_.
(The format of our PDB-style files is described here.)

Timeline for d4ldtc_: