SCOPe 2.03: Domain d4ld8a2: 4ld8 A:203-308

Lineage for d4ld8a2 (4ld8 A:203-308)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.31: EV matrix protein [50011] (1 superfamily)
   consists of two beta-sandwich domains of similar topologies

4. Superfamily b.31.1: EV matrix protein [50012] (2 families)

5. Family b.31.1.1: EV matrix protein [50013] (2 proteins)

6. Protein automated matches [227095] (2 species)
   not a true protein

7. Species Sudan ebolavirus [TaxId:186540] [235344] (1 PDB entry)

8. Domain d4ld8a2: 4ld8 A:203-308 [235346]
   automated match to d1es6a2

Details for d4ld8a2

PDB Entry: 4ld8, 1.83 Å

PDB Description: Crystal Structure of Dimeric Sudan Virus VP40

PDB Compounds: (A:) matrix protein vp40

SCOPe Domain Sequences for d4ld8a2:

Sequence, based on SEQRES records:

>d4ld8a2 b.31.1.1 (A:203-308) automated matches {Sudan ebolavirus [TaxId: 186540]}
lrpglsfhpklrpvllpgktgkkghvsdltapdkiqtivnlmqdfkivpidpaksiigie
vpellvhkltgkkmsqkngqpiipvllpkyigldpispgdltmvit

Sequence, based on observed residues (ATOM records):

>d4ld8a2 b.31.1.1 (A:203-308) automated matches {Sudan ebolavirus [TaxId: 186540]}
lrpglsfhpklrpvllpgkdkiqtivnlmqdfkivpidpaksiigievpellvhkltgkk
kngqpiipvllpkyigpgdltmvit

Timeline for d4ld8a2:

• d4ld8a2 is new in SCOPe 2.03-stable
  
• d4ld8a2 appears in SCOPe 2.04
  
• d4ld8a2 appears in the current release, SCOPe 2.08