Lineage for d4ld8a2 (4ld8 A:203-308)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782271Fold b.31: EV matrix protein [50011] (1 superfamily)
    consists of two beta-sandwich domains of similar topologies
  4. 2782272Superfamily b.31.1: EV matrix protein [50012] (2 families) (S)
  5. 2782273Family b.31.1.1: EV matrix protein [50013] (2 proteins)
  6. 2782281Protein automated matches [227095] (4 species)
    not a true protein
  7. 2782292Species Sudan ebolavirus [TaxId:186540] [235344] (1 PDB entry)
  8. 2782294Domain d4ld8a2: 4ld8 A:203-308 [235346]
    automated match to d1es6a2

Details for d4ld8a2

PDB Entry: 4ld8 (more details), 1.83 Å

PDB Description: Crystal Structure of Dimeric Sudan Virus VP40
PDB Compounds: (A:) matrix protein vp40

SCOPe Domain Sequences for d4ld8a2:

Sequence, based on SEQRES records: (download)

>d4ld8a2 b.31.1.1 (A:203-308) automated matches {Sudan ebolavirus [TaxId: 186540]}
lrpglsfhpklrpvllpgktgkkghvsdltapdkiqtivnlmqdfkivpidpaksiigie
vpellvhkltgkkmsqkngqpiipvllpkyigldpispgdltmvit

Sequence, based on observed residues (ATOM records): (download)

>d4ld8a2 b.31.1.1 (A:203-308) automated matches {Sudan ebolavirus [TaxId: 186540]}
lrpglsfhpklrpvllpgkdkiqtivnlmqdfkivpidpaksiigievpellvhkltgkk
kngqpiipvllpkyigpgdltmvit

SCOPe Domain Coordinates for d4ld8a2:

Click to download the PDB-style file with coordinates for d4ld8a2.
(The format of our PDB-style files is described here.)

Timeline for d4ld8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ld8a1