![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.31: EV matrix protein [50011] (1 superfamily) consists of two beta-sandwich domains of similar topologies |
![]() | Superfamily b.31.1: EV matrix protein [50012] (2 families) ![]() |
![]() | Family b.31.1.1: EV matrix protein [50013] (2 proteins) |
![]() | Protein automated matches [227095] (4 species) not a true protein |
![]() | Species Sudan ebolavirus [TaxId:186540] [235344] (1 PDB entry) |
![]() | Domain d4ld8a2: 4ld8 A:203-308 [235346] automated match to d1es6a2 |
PDB Entry: 4ld8 (more details), 1.83 Å
SCOPe Domain Sequences for d4ld8a2:
Sequence, based on SEQRES records: (download)
>d4ld8a2 b.31.1.1 (A:203-308) automated matches {Sudan ebolavirus [TaxId: 186540]} lrpglsfhpklrpvllpgktgkkghvsdltapdkiqtivnlmqdfkivpidpaksiigie vpellvhkltgkkmsqkngqpiipvllpkyigldpispgdltmvit
>d4ld8a2 b.31.1.1 (A:203-308) automated matches {Sudan ebolavirus [TaxId: 186540]} lrpglsfhpklrpvllpgkdkiqtivnlmqdfkivpidpaksiigievpellvhkltgkk kngqpiipvllpkyigpgdltmvit
Timeline for d4ld8a2: