![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.31: EV matrix protein [50011] (1 superfamily) consists of two beta-sandwich domains of similar topologies |
![]() | Superfamily b.31.1: EV matrix protein [50012] (2 families) ![]() |
![]() | Family b.31.1.1: EV matrix protein [50013] (2 proteins) |
![]() | Protein automated matches [227095] (4 species) not a true protein |
![]() | Species Sudan ebolavirus [TaxId:186540] [235344] (1 PDB entry) |
![]() | Domain d4ld8a1: 4ld8 A:44-193 [235345] automated match to d1es6a1 |
PDB Entry: 4ld8 (more details), 1.83 Å
SCOPe Domain Sequences for d4ld8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ld8a1 b.31.1.1 (A:44-193) automated matches {Sudan ebolavirus [TaxId: 186540]} mdtpsnsmrpvaddnidhtshtpngvasafileatvnvisgpkvlmkqipiwlplgiadq ktysfdsttaaimlasytithfgkannplvrvnrlgqgipdhplrllrmgnqaflqefvl ppvqlpqyftfdltalklvtqplpaatwtd
Timeline for d4ld8a1: