| Class b: All beta proteins [48724] (180 folds) |
| Fold b.31: EV matrix protein [50011] (1 superfamily) consists of two beta-sandwich domains of similar topologies |
Superfamily b.31.1: EV matrix protein [50012] (2 families) ![]() |
| Family b.31.1.1: EV matrix protein [50013] (2 proteins) |
| Protein automated matches [227095] (4 species) not a true protein |
| Species Sudan ebolavirus [TaxId:186540] [235344] (1 PDB entry) |
| Domain d4ld8a1: 4ld8 A:44-193 [235345] automated match to d1es6a1 |
PDB Entry: 4ld8 (more details), 1.83 Å
SCOPe Domain Sequences for d4ld8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ld8a1 b.31.1.1 (A:44-193) automated matches {Sudan ebolavirus [TaxId: 186540]}
mdtpsnsmrpvaddnidhtshtpngvasafileatvnvisgpkvlmkqipiwlplgiadq
ktysfdsttaaimlasytithfgkannplvrvnrlgqgipdhplrllrmgnqaflqefvl
ppvqlpqyftfdltalklvtqplpaatwtd
Timeline for d4ld8a1: