SCOPe 2.07: Domain d4lcwe1: 4lcw E:2-116

Lineage for d4lcwe1 (4lcw E:2-116)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4lcwe1: 4lcw E:2-116 [235342]
   Other proteins in same PDB: d4lcwa1, d4lcwa3, d4lcwb_, d4lcwc1, d4lcwc3, d4lcwd2, d4lcwf_, d4lcwg2
   automated match to d4l4te1
   complexed with 1vy, gol

Details for d4lcwe1

PDB Entry: 4lcw, 2.4 Å

PDB Description: The structure of human MAIT TCR in complex with MR1-K43A-RL-6-Me-7OH

PDB Compounds: (E:) MAIT T cell receptor beta chain

SCOPe Domain Sequences for d4lcwe1:

Sequence; same for both SEQRES and ATOM records:

>d4lcwe1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d4lcwe1:

• d4lcwe1 first appeared in SCOPe 2.03
  
• d4lcwe1 appears in SCOPe 2.06
  
• d4lcwe1 appears in the current release, SCOPe 2.08