Lineage for d4lcwh1 (4lcw H:3-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756286Domain d4lcwh1: 4lcw H:3-116 [235340]
    Other proteins in same PDB: d4lcwa1, d4lcwa3, d4lcwb_, d4lcwc1, d4lcwc3, d4lcwd2, d4lcwf_, d4lcwg2
    automated match to d4l4vh1
    complexed with 1vy, gol

Details for d4lcwh1

PDB Entry: 4lcw (more details), 2.4 Å

PDB Description: The structure of human MAIT TCR in complex with MR1-K43A-RL-6-Me-7OH
PDB Compounds: (H:) MAIT T cell receptor beta chain

SCOPe Domain Sequences for d4lcwh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lcwh1 b.1.1.0 (H:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

SCOPe Domain Coordinates for d4lcwh1:

Click to download the PDB-style file with coordinates for d4lcwh1.
(The format of our PDB-style files is described here.)

Timeline for d4lcwh1: