Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (41 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [193082] (5 PDB entries) |
Domain d4ld5h_: 4ld5 H: [235335] automated match to d4ld5d_ complexed with so4; mutant |
PDB Entry: 4ld5 (more details), 2.4 Å
SCOPe Domain Sequences for d4ld5h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ld5h_ a.4.5.0 (H:) automated matches {Staphylococcus aureus [TaxId: 1280]} meftysylfrmishemkpkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls eeeneqmkanltkmlsslq
Timeline for d4ld5h_: