Class b: All beta proteins [48724] (177 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
Protein automated matches [190497] (4 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (10 PDB entries) |
Domain d4lcvb1: 4lcv B:125-254 [235326] Other proteins in same PDB: d4lcvb2 automated match to d4lcvd_ complexed with bme, ca, flc, so4 |
PDB Entry: 4lcv (more details), 2 Å
SCOPe Domain Sequences for d4lcvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lcvb1 b.7.1.0 (B:125-254) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} talgtldfsllydqennalhctiskakglkpmdhngladpyvklhllpgaskanklrtkt lrntlnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkklkpnhtk tfsiclekql
Timeline for d4lcvb1: