![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
![]() | Protein automated matches [190497] (3 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (8 PDB entries) |
![]() | Domain d4lcva_: 4lcv A: [235325] automated match to d4lcvd_ complexed with bme, ca, flc, so4 |
PDB Entry: 4lcv (more details), 2 Å
SCOPe Domain Sequences for d4lcva_:
Sequence, based on SEQRES records: (download)
>d4lcva_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} algtldfsllydqennalhctiskakglkpmdhngladpyvklhllpgaskanklrtktl rntlnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkklkpnhtkt fsiclekq
>d4lcva_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} algtldfsllydqennalhctiskakglkpladpyvklhllpgaskanklrtktlrntln pswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkklkpnhtktfsicl ekq
Timeline for d4lcva_: