SCOPe 2.03: Domain d4lcva_: 4lcv A:

Lineage for d4lcva_ (4lcv A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (8 PDB entries)

8. Domain d4lcva_: 4lcv A: [235325]
   automated match to d4lcvd_
   complexed with bme, ca, flc, so4

Details for d4lcva_

PDB Entry: 4lcv, 2 Å

PDB Description: Crystal Structure of DOC2B C2A domain

PDB Compounds: (A:) Double C2-like domain-containing protein beta

SCOPe Domain Sequences for d4lcva_:

Sequence, based on SEQRES records:

>d4lcva_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
algtldfsllydqennalhctiskakglkpmdhngladpyvklhllpgaskanklrtktl
rntlnpswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkklkpnhtkt
fsiclekq

Sequence, based on observed residues (ATOM records):

>d4lcva_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
algtldfsllydqennalhctiskakglkpladpyvklhllpgaskanklrtktlrntln
pswnetltyygitdedmirktlrisvcdedkfrhnefigetrvplkklkpnhtktfsicl
ekq

Timeline for d4lcva_:

• d4lcva_ is new in SCOPe 2.03-stable
  
• d4lcva_ appears in SCOPe 2.04
  
• d4lcva_ appears in the current release, SCOPe 2.08