SCOPe 2.05: Domain d4lash_: 4las H:

Lineage for d4lash_ (4las H:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)

8. Domain d4lash_: 4las H: [235322]
   Other proteins in same PDB: d4lasl_
   automated match to d4larh_
   complexed with 1wf

Details for d4lash_

PDB Entry: 4las, 2.33 Å

PDB Description: crystal structure of a therapeutic single chain antibody in complex with 4-hydroxymethamphetamine

PDB Compounds: (H:) Single heavy chain Variable fragment

SCOPe Domain Sequences for d4lash_:

Sequence; same for both SEQRES and ATOM records:

>d4lash_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyisyrgstyyn
pslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameywgqgtsvtvs

Timeline for d4lash_:

• d4lash_ first appeared in SCOPe 2.03
  
• d4lash_ appears in SCOPe 2.04
  
• d4lash_ appears in SCOPe 2.06
  
• d4lash_ appears in the current release, SCOPe 2.07