| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
| Protein FKBP52, N-terminal domains [82619] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82620] (11 PDB entries) Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains |
| Domain d4lawa1: 4law A:21-140 [235315] automated match to d1q1ca1 complexed with dms |
PDB Entry: 4law (more details), 2.4 Å
SCOPe Domain Sequences for d4lawa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lawa1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
egvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkdkfsfd
lgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkge
Timeline for d4lawa1: