SCOPe 2.03: Domain d4la9b_: 4la9 B:

Lineage for d4la9b_ (4la9 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (57 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:272623] [227880] (4 PDB entries)

8. Domain d4la9b_: 4la9 B: [235313]
   automated match to d4la9a_
   complexed with peg, po4

Details for d4la9b_

PDB Entry: 4la9, 1.3 Å

PDB Description: crystal structure of an empty substrate binding domain 1 (sbd1) of abc transporter glnpq from lactococcus lactis

PDB Compounds: (B:) Glutamine ABC transporter permease and substrate binding protein protein

SCOPe Domain Sequences for d4la9b_:

Sequence; same for both SEQRES and ATOM records:

>d4la9b_ c.94.1.0 (B:) automated matches {Lactococcus lactis [TaxId: 272623]}
ettvkiasdssyapfefqngqkkwvgidvdimqevakindwklemsypgfdaalqnlkag
qvdgiiagmtitderketfdfsnpyytsaltiattkdsklsdysdlkgkavgakngtaaq
twlqenqkkygytiktysdgvhmfaalssgniagamdevpvisyamkqgqdlamnfpsis
lpggygfavmkgknstlvdgfnkalaemksngdydkilkkygita

Timeline for d4la9b_:

• d4la9b_ is new in SCOPe 2.03-stable
  
• d4la9b_ appears in SCOPe 2.04
  
• d4la9b_ appears in the current release, SCOPe 2.08