![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries) |
![]() | Domain d4l9ta1: 4l9t A:1-139 [235311] Other proteins in same PDB: d4l9ta2 automated match to d4l9va_ complexed with so4; mutant |
PDB Entry: 4l9t (more details), 1.79 Å
SCOPe Domain Sequences for d4l9ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l9ta1 a.4.5.0 (A:1-139) automated matches {Staphylococcus aureus [TaxId: 1280]} meftysylfrmishemkqkadqkleqlditneqghtlgylyahqqdgltqndiakalqrt gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls eeeneqmkanltkmlsslq
Timeline for d4l9ta1: