SCOPe 2.08: Domain d4l9ta1: 4l9t A:1-139

Lineage for d4l9ta1 (4l9t A:1-139)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries)

8. Domain d4l9ta1: 4l9t A:1-139 [235311]
   Other proteins in same PDB: d4l9ta2
   automated match to d4l9va_
   complexed with so4; mutant

Details for d4l9ta1

PDB Entry: 4l9t, 1.79 Å

PDB Description: crystal structure of mepr f27l mutant from multidrug resistant s. aureus clinical isolate

PDB Compounds: (A:) MepR

SCOPe Domain Sequences for d4l9ta1:

Sequence; same for both SEQRES and ATOM records:

>d4l9ta1 a.4.5.0 (A:1-139) automated matches {Staphylococcus aureus [TaxId: 1280]}
meftysylfrmishemkqkadqkleqlditneqghtlgylyahqqdgltqndiakalqrt
gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
eeeneqmkanltkmlsslq

Timeline for d4l9ta1:

• d4l9ta1 first appeared in SCOPe 2.03, called d4l9ta_
  
• d4l9ta1 appears in SCOPe 2.07