Lineage for d4l75c2 (4l75 C:245-336)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1448316Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 1448317Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 1448348Family d.286.1.0: automated matches [228502] (1 protein)
    not a true family
  6. 1448349Protein automated matches [228504] (1 species)
    not a true protein
  7. 1448350Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (6 PDB entries)
  8. 1448357Domain d4l75c2: 4l75 C:245-336 [235304]
    Other proteins in same PDB: d4l75a1, d4l75b1, d4l75c1, d4l75d1, d4l75e1, d4l75f1
    automated match to d4l75d2
    complexed with ca; mutant

Details for d4l75c2

PDB Entry: 4l75 (more details), 2.39 Å

PDB Description: ca2+-bound d184n mutant mthk rck domain at 2.4 angstrom
PDB Compounds: (C:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4l75c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l75c2 d.286.1.0 (C:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

SCOPe Domain Coordinates for d4l75c2:

Click to download the PDB-style file with coordinates for d4l75c2.
(The format of our PDB-style files is described here.)

Timeline for d4l75c2: