![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein automated matches [190381] (8 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187229] (7 PDB entries) |
![]() | Domain d4l6te1: 4l6t E:22-125 [235295] Other proteins in same PDB: d4l6tb2, d4l6tc2, d4l6td2, d4l6te2, d4l6tf2 automated match to d4l6tb_ complexed with zn |
PDB Entry: 4l6t (more details), 1.86 Å
SCOPe Domain Sequences for d4l6te1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l6te1 b.40.2.1 (E:22-125) automated matches {Escherichia coli [TaxId: 562]} mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsn
Timeline for d4l6te1: