Lineage for d4l6te1 (4l6t E:22-125)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788746Protein automated matches [190381] (11 species)
    not a true protein
  7. 2788786Species Escherichia coli [TaxId:562] [187229] (8 PDB entries)
  8. 2788830Domain d4l6te1: 4l6t E:22-125 [235295]
    Other proteins in same PDB: d4l6tb2, d4l6tc2, d4l6td2, d4l6te2, d4l6tf2
    automated match to d4l6tb_
    complexed with zn

Details for d4l6te1

PDB Entry: 4l6t (more details), 1.86 Å

PDB Description: gm1 bound form of the ecx ab5 holotoxin
PDB Compounds: (E:) ecxb

SCOPe Domain Sequences for d4l6te1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l6te1 b.40.2.1 (E:22-125) automated matches {Escherichia coli [TaxId: 562]}
mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsn

SCOPe Domain Coordinates for d4l6te1:

Click to download the PDB-style file with coordinates for d4l6te1.
(The format of our PDB-style files is described here.)

Timeline for d4l6te1: