Lineage for d4l75b2 (4l75 B:245-336)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009722Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 3009723Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 3009754Family d.286.1.0: automated matches [228502] (1 protein)
    not a true family
  6. 3009755Protein automated matches [228504] (1 species)
    not a true protein
  7. 3009756Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries)
  8. 3009770Domain d4l75b2: 4l75 B:245-336 [235294]
    Other proteins in same PDB: d4l75a1, d4l75a3, d4l75b1, d4l75b3, d4l75c1, d4l75d1, d4l75d3, d4l75e1, d4l75f1, d4l75f3
    automated match to d4l75d2
    complexed with ca; mutant

Details for d4l75b2

PDB Entry: 4l75 (more details), 2.39 Å

PDB Description: ca2+-bound d184n mutant mthk rck domain at 2.4 angstrom
PDB Compounds: (B:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4l75b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l75b2 d.286.1.0 (B:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

SCOPe Domain Coordinates for d4l75b2:

Click to download the PDB-style file with coordinates for d4l75b2.
(The format of our PDB-style files is described here.)

Timeline for d4l75b2: