SCOP 1.63: Domain d1c8m2_: 1c8m 2:

Lineage for d1c8m2_ (1c8m 2:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll
   variations: some members have additional 1-2 strands

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.4: Animal virus proteins [49656] (18 proteins)
   mammalian viruses

6. Protein Rhinovirus coat protein [49670] (5 species)

7. Species Human rhinovirus 16 [TaxId:31708] [49672] (6 PDB entries)

8. Domain d1c8m2_: 1c8m 2: [23529]

Details for d1c8m2_

PDB Entry: 1c8m, 2.8 Å

PDB Description: refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials

SCOP Domain Sequences for d1c8m2_:

Sequence; same for both SEQRES and ATOM records:

>d1c8m2_ b.10.1.4 (2:) Rhinovirus coat protein {Human rhinovirus 16}
sdriiqitrgdstitsqdvanavvgygvwphyltpqdataidkptqpdtssnrfytldsk
mwnstskgwwwklpdalkdmgifgenmfyhflgrsgytvhvqcnaskfhqgtllvvmipe
hqlatvnkgnvnagykythpgeagrevgtqvenekqpsddnwlnfdgtllgnllifphqf
inlrsnnsatlivpyvnavpmdsmvrhnnwslviipvcqlqsnnisnivpitvsispmca
efsgaraktvvq

Timeline for d1c8m2_:

• d1c8m2_ first appeared (with stable ids) in SCOP 1.55
  
• d1c8m2_ appears in SCOP 1.61
  
• d1c8m2_ does not appear in SCOP 1.65