SCOPe 2.05: Domain d4l63f_: 4l63 F:

Lineage for d4l63f_ (4l63 F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein automated matches [190381] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187229] (7 PDB entries)

8. Domain d4l63f_: 4l63 F: [235282]
   automated match to d4l6tb_
   complexed with epe, zn

Details for d4l63f_

PDB Entry: 4l63, 1.8 Å

PDB Description: Apo form of AB5 holotoxin

PDB Compounds: (F:) ecxb

SCOPe Domain Sequences for d4l63f_:

Sequence; same for both SEQRES and ATOM records:

>d4l63f_ b.40.2.1 (F:) automated matches {Escherichia coli [TaxId: 562]}
tpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhles
qkrplermkdtlraayftgikisklcawtnkspnsiaaielsn

Timeline for d4l63f_:

• d4l63f_ first appeared in SCOPe 2.03
  
• d4l63f_ appears in SCOPe 2.04
  
• d4l63f_ appears in SCOPe 2.06
  
• d4l63f_ appears in the current release, SCOPe 2.08