Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (4 species) not a true protein |
Species Escherichia coli [TaxId:562] [187229] (6 PDB entries) |
Domain d4l63d_: 4l63 D: [235281] automated match to d4l6tb_ complexed with epe, zn |
PDB Entry: 4l63 (more details), 1.8 Å
SCOPe Domain Sequences for d4l63d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l63d_ b.40.2.1 (D:) automated matches {Escherichia coli [TaxId: 562]} mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsnl
Timeline for d4l63d_:
View in 3D Domains from other chains: (mouse over for more information) d4l63b_, d4l63c_, d4l63e_, d4l63f_ |