SCOPe 2.08: Domain d4l63d1: 4l63 D:0-103

Lineage for d4l63d1 (4l63 D:0-103)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein automated matches [190381] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187229] (8 PDB entries)

8. Domain d4l63d1: 4l63 D:0-103 [235281]
   Other proteins in same PDB: d4l63b2, d4l63c2, d4l63d2, d4l63e2
   automated match to d4l6tb_
   complexed with epe, zn

Details for d4l63d1

PDB Entry: 4l63, 1.8 Å

PDB Description: Apo form of AB5 holotoxin

PDB Compounds: (D:) ecxb

SCOPe Domain Sequences for d4l63d1:

Sequence; same for both SEQRES and ATOM records:

>d4l63d1 b.40.2.1 (D:0-103) automated matches {Escherichia coli [TaxId: 562]}
mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsn

Timeline for d4l63d1:

• d4l63d1 first appeared in SCOPe 2.03, called d4l63d_
  
• d4l63d1 appears in SCOPe 2.07