Lineage for d4l63b1 (4l63 B:0-103)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398373Protein automated matches [190381] (11 species)
    not a true protein
  7. 2398413Species Escherichia coli [TaxId:562] [187229] (8 PDB entries)
  8. 2398449Domain d4l63b1: 4l63 B:0-103 [235280]
    Other proteins in same PDB: d4l63b2, d4l63c2, d4l63d2, d4l63e2
    automated match to d4l6tb_
    complexed with epe, zn

Details for d4l63b1

PDB Entry: 4l63 (more details), 1.8 Å

PDB Description: Apo form of AB5 holotoxin
PDB Compounds: (B:) ecxb

SCOPe Domain Sequences for d4l63b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l63b1 b.40.2.1 (B:0-103) automated matches {Escherichia coli [TaxId: 562]}
mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsn

SCOPe Domain Coordinates for d4l63b1:

Click to download the PDB-style file with coordinates for d4l63b1.
(The format of our PDB-style files is described here.)

Timeline for d4l63b1: