Lineage for d4l63b_ (4l63 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1313713Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1314172Protein automated matches [190381] (4 species)
    not a true protein
  7. 1314195Species Escherichia coli [TaxId:562] [187229] (6 PDB entries)
  8. 1314231Domain d4l63b_: 4l63 B: [235280]
    automated match to d4l6tb_
    complexed with epe, zn

Details for d4l63b_

PDB Entry: 4l63 (more details), 1.8 Å

PDB Description: Apo form of AB5 holotoxin
PDB Compounds: (B:) ecxb

SCOPe Domain Sequences for d4l63b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l63b_ b.40.2.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
mtpqnitdlcneyqntmiyslnkeiatyteslagkremviisfsngatfqvevpgsqhle
sqkrplermkdtlraayftgikisklcawtnkspnsiaaielsnl

SCOPe Domain Coordinates for d4l63b_:

Click to download the PDB-style file with coordinates for d4l63b_.
(The format of our PDB-style files is described here.)

Timeline for d4l63b_: