![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Clonorchis sinensis [TaxId:79923] [225958] (3 PDB entries) |
![]() | Domain d4l5oc2: 4l5o C:81-217 [235278] Other proteins in same PDB: d4l5oa1, d4l5ob1, d4l5oc1 automated match to d4l5ob2 complexed with gsh, so4, zn; mutant |
PDB Entry: 4l5o (more details), 2.09 Å
SCOPe Domain Sequences for d4l5oc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l5oc2 a.45.1.0 (C:81-217) automated matches {Clonorchis sinensis [TaxId: 79923]} migntpverakismiegglvdlragvsriayqetfeqlkvpylqqlpstlrmwsqflgnn sylhgstpthldfmfyealdviryldptsveafpnlmqfihriealpnikafmesdrfik wplngwsayfgggdapp
Timeline for d4l5oc2:
![]() Domains from other chains: (mouse over for more information) d4l5oa1, d4l5oa2, d4l5ob1, d4l5ob2 |