SCOPe 2.08: Domain d4l5oa2: 4l5o A:81-217

Lineage for d4l5oa2 (4l5o A:81-217)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Clonorchis sinensis [TaxId:79923] [225958] (3 PDB entries)

8. Domain d4l5oa2: 4l5o A:81-217 [235276]
   Other proteins in same PDB: d4l5oa1, d4l5ob1, d4l5oc1
   automated match to d4l5ob2
   complexed with gsh, so4, zn; mutant

Details for d4l5oa2

PDB Entry: 4l5o, 2.09 Å

PDB Description: crystal structure of 26 kda gst d26h mutant of clonorchis sinensis

PDB Compounds: (A:) putative glutathione transferase

SCOPe Domain Sequences for d4l5oa2:

Sequence; same for both SEQRES and ATOM records:

>d4l5oa2 a.45.1.0 (A:81-217) automated matches {Clonorchis sinensis [TaxId: 79923]}
migntpverakismiegglvdlragvsriayqetfeqlkvpylqqlpstlrmwsqflgnn
sylhgstpthldfmfyealdviryldptsveafpnlmqfihriealpnikafmesdrfik
wplngwsayfgggdapp

Timeline for d4l5oa2:

• d4l5oa2 first appeared in SCOPe 2.03
  
• d4l5oa2 appears in SCOPe 2.07