Lineage for d4l5oa1 (4l5o A:1-80)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854797Species Clonorchis sinensis [TaxId:79923] [225957] (3 PDB entries)
  8. 1854800Domain d4l5oa1: 4l5o A:1-80 [235275]
    Other proteins in same PDB: d4l5oa2, d4l5ob2, d4l5oc2
    automated match to d4l5ob1
    complexed with gsh, so4, zn; mutant

Details for d4l5oa1

PDB Entry: 4l5o (more details), 2.09 Å

PDB Description: crystal structure of 26 kda gst d26h mutant of clonorchis sinensis
PDB Compounds: (A:) putative glutathione transferase

SCOPe Domain Sequences for d4l5oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l5oa1 c.47.1.0 (A:1-80) automated matches {Clonorchis sinensis [TaxId: 79923]}
mapvlgywkirglaqpirllleyvghsyeehsygrcdgekwqndkhnlglelpnlpyykd
gnfsltqslailryiadkhn

SCOPe Domain Coordinates for d4l5oa1:

Click to download the PDB-style file with coordinates for d4l5oa1.
(The format of our PDB-style files is described here.)

Timeline for d4l5oa1: