SCOPe 2.08: Domain d4l5ma1: 4l5m A:56-249

Lineage for d4l5ma1 (4l5m A:56-249)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.3: Sec7 domain [48425] (2 families)

5. Family a.118.3.0: automated matches [191673] (1 protein)
   not a true family

6. Protein automated matches [191283] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries)

8. Domain d4l5ma1: 4l5m A:56-249 [235270]
   Other proteins in same PDB: d4l5ma2
   automated match to d4jwla_
   complexed with hrc, po4

Details for d4l5ma1

PDB Entry: 4l5m, 1.8 Å

PDB Description: complexe of arno sec7 domain with the protein-protein interaction inhibitor n-(4-hydroxy-2,6-dimethylphenyl)benzenesulfonamide at ph6.5

PDB Compounds: (A:) Cytohesin-2

SCOPe Domain Sequences for d4l5ma1:

Sequence; same for both SEQRES and ATOM records:

>d4l5ma1 a.118.3.0 (A:56-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdyl
gereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcn
pgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrnly
dsirnepfkipedd

Timeline for d4l5ma1:

• d4l5ma1 first appeared in SCOPe 2.03, called d4l5ma_
  
• d4l5ma1 appears in SCOPe 2.07