Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d4l4ta2: 4l4t A:179-269 [235265] Other proteins in same PDB: d4l4ta1, d4l4ta3, d4l4tb_, d4l4tc1, d4l4tc3, d4l4td2, d4l4tf_, d4l4tg2 automated match to d1k5na1 complexed with 6fp |
PDB Entry: 4l4t (more details), 2 Å
SCOPe Domain Sequences for d4l4ta2:
Sequence, based on SEQRES records: (download)
>d4l4ta2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty qawasieldpqssnlyschvehsgvhmvlqv
>d4l4ta2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty qawasiellyschvehsgvhmvlqv
Timeline for d4l4ta2: